PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g086250.1
Common NameMTR_1g086250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 1004aa    MW: 111555 Da    PI: 6.1171
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g086250.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.2e-40146223178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+C adls+ k+yhrrhkvCe+hska+ +lv + +qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Medtr1g086250.1 146 VCQVEDCGADLSRGKDYHRRHKVCEMHSKASRALVGNAMQRFCQQCSRFHILEEFDEGKRSCRRRLAGHNKRRRKTNQ 223
                      6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-32140208IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.778144221IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-37145225IPR004333Transcription factor, SBP-box
PfamPF031105.5E-29147220IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.204.3E-8743890IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484037.6E-9758889IPR020683Ankyrin repeat-containing domain
CDDcd002048.69E-8777888No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MGERLGAENY HFYGVGGSSD LSGMGKRSRE WNLNDWRWDG DLFIASRVNQ VQAESLRVGQ  60
QFFPLGSGIP VVGGSSNTSS SCSEEGDLEK GNKEGEKKRR VIVLEDDGLN DKAGALSLNL  120
AGHVSPVVER DGKKSRGAGG TSNRAVCQVE DCGADLSRGK DYHRRHKVCE MHSKASRALV  180
GNAMQRFCQQ CSRFHILEEF DEGKRSCRRR LAGHNKRRRK TNQEAVPNGS PTNDDQTSSY  240
LLISLLKILS NMHSDRSDQP TDQDLLTHLL RSLASQNDEQ GSKNLSNLLR EQENLLREGG  300
SSRNSGMVSA LFSNGSQGSP TVITQHQPVS MNQMQQEMVH THDVRTSDHQ LISSIKPSIS  360
NSPPAYSETR DSSGQTKMNN FDLNDIYVDS DDGTEDLERL PVSTNLATSS VDYPWTQQDS  420
HQSSPAQTSG NSDSASAQSP SSSSGEAQSR TDRIVFKLFG KEPNEFPLVL RAQILDWLSQ  480
SPTDIESYIR PGCIVLTIYL RQAEAVWEEL CCDLTSSLIK LLDVSDDTFW KTGWVHIRVQ  540
HQMAFIFNGQ VVIDTSLPFR SNNYSKIWTV SPIAVPASKR AQFSVKGVNL MRPATRLMCA  600
LEGKYLVCED AHESTDQYSE ELDELQCIQF SCSVPVSNGR GFIEIEDQGL SSSFFPFIVA  660
EEDVCTEIRV LEPLLESSET DPDIEGTGKI KAKSQAMDFI HEMGWLLHRS QLKYRMVNLN  720
SGVDLFPLQR FTWLMEFSMD HDWCAVVKKL LNLLLDETVN KGDHPTLYQA LSEMGLLHRA  780
VRRNSKQLVE LLLRYVPDNT SDELGPEDKA LVGGKNHSYL FRPDAVGPAG LTPLHIAAGK  840
DGSEDVLDAL TNDPCMVGIE AWKNARDSTG STPEDYARLR GHYTYIHLVQ KKINKTQGAA  900
HVVVEIPSNM TESNKNPKQN ESFTSLEIGK AEVRRSQGNC KLCDTKISCR TAVGRSMVYR  960
PAMLSMVAIA AVCVCVALLF KSSPEVLYMF RPFRWESLDF GTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-31137220184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.42330.0flower| leaf| pod| root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591325.10.0squamosa promoter-binding-like protein
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLG7IBS50.0G7IBS5_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA02G01160.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]